PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004498359.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 208aa    MW: 24404.9 Da    PI: 9.5273
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004498359.2genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.57.1e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien+snrqvt+skR+ngilKKA+E+ vLCda+v++iif+ +gk+++y+s
  XP_004498359.2  9 KRIENSSNRQVTYSKRKNGILKKAKEITVLCDAKVSLIIFAASGKMHDYIS 59
                    79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.693161IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-35296IPR002100Transcription factor, MADS-box
CDDcd002653.23E-39280No hitNo description
PRINTSPR004042.2E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003199.9E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-273859IPR002100Transcription factor, MADS-box
PfamPF014869.1E-1982161IPR002487Transcription factor, K-box
PROSITE profilePS5129714.29284170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRKNGILK KAKEITVLCD AKVSLIIFAA SGKMHDYISP  60
STTLIDILER YHKTSGKRLW DAKHENLSNE IERLKKENDG MQVELRHLKG EDINSLHYKE  120
LMSLEDALEN GLLTIREKQM EVYRMIRRND KILEEENREL NFILQQRMAV EGAREVENGF  180
NQSGRDFNSQ MPFSYRVQPM QPNLHERI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A4e-16297190Myocyte-specific enhancer factor 2A
3kov_B4e-16297190Myocyte-specific enhancer factor 2A
3kov_I4e-16297190Myocyte-specific enhancer factor 2A
3kov_J4e-16297190Myocyte-specific enhancer factor 2A
3p57_A4e-16297190Myocyte-specific enhancer factor 2A
3p57_B4e-16297190Myocyte-specific enhancer factor 2A
3p57_C4e-16297190Myocyte-specific enhancer factor 2A
3p57_D4e-16297190Myocyte-specific enhancer factor 2A
3p57_I4e-16297190Myocyte-specific enhancer factor 2A
3p57_J4e-16297190Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498359.21e-153PREDICTED: floral homeotic protein PMADS 2-like
SwissprotQ074741e-106MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLV7CTA81e-137V7CTA8_PHAVU; Uncharacterized protein
TrEMBLA0A0S3RNJ91e-137A0A0S3RNJ9_PHAAN; Uncharacterized protein
STRINGGLYMA13G09660.11e-135(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43553255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.13e-87MIKC_MADS family protein